#yavrukedisahiplen

4,975 posts tagged with #yavrukedisahiplen

Photos and Videos about #yavrukedisahiplen

#repost @istanbulkedisahiplendirme with @get_repost ・・・ Bu güzel surata yuva aranıyor. Tatlılığa bakın😍 . . İlan metni: . ANKARA. İki aylık erkek, bir aydır klinikte tedavi görüyor. Gözleri puslu ama görüyor. Damla damlatmak gerekiyor gözlerine onun dışında ekstra bi bakıma ihtiyacı yok. Ankara içi ulaşımını sağlayabilirim. Yuva olmak isterseniz: 05363966979. . . . #kedisahiplendirme #kedisahiplen #kedisahiplenme #kedisahiplendir #yuvaol #yuvaarıyor #yuvaaranıyor #acilyuva #yuvaolhayatkurtar #yuva #kediyuva #satınalmasahiplen #satinalmasahiplen #yavrukedisahiplen #yavrukedi #kedilerindünyası #kediler #kedi #acilyuvaaranıyor #kediseverler #istanbulkedisahiplendirme

Happy Cat Junior Tavuk ve Somonlu Yavru Kedi Maması 1,4 Kg 5 haftadan 12 aya kadar tüm ırk yavru kediler için – 5 haftadan 12 aya kadar yavru kediler için süper premium mama – Ayrıca hassas kediler için de idealdir – Tüm ırklar için uygundur – Protein kaynağı; Tavuk eti, biftek, somon balığı, tavşan, yumurta Bileşimi: Tavuk eti, hayvansal yağ, pirinç unu, mısır unu, mısır, somon unu, kanatlı katı yağı, sığır eti yağı, tavşan unu, hidrolize ciğer, pancar lifi, kurutulmuş karaciğer, elma lifi, yumurta tozu, sodyum klorür, maya (kurutulmuş), potasyum klorür, mayalanmış arpa, deniz yosunu, keten tohumu, bitkisel karışım, hindiba (özütü) Sindirilebilir Enerji: 1765 kJ/ 100 g Analiz:Ham protein (%) 34,0-Ham lif (%) 2,5-Nem (%) 10,0-E Vitamini (mg) 120-A Vitamini (I.E.) 25000-Ham katı yağ (%) 19,0-D₃ Vitamini (I.E.) 2000-Mineraller (%) 6,0-B₁ Vitamini (mg) 6-B₂ Vitamini (mg) 6-Kalsiyum (%) -1,25-Pantotenik asit (mg) 15-Fosfor (%) 0,8-Niyasin (mg) 60-Potasyum (%) 0,45-B₆ Vitamini (mg) 5-Sodyum (%) 0,45-Biotin (mcg) 1000-Magnezyum (%) 0,07-B₁₂ Vitamini (mcg) 100 #scottishfoldkitten #scottishfold#britishshorthair #gununfotosu #yavrukedi#yavrukedisahiplen#scottishfoldkitten #petstagram #petsagram #photooftheday#catsofinstagram #pets #animal #animals#petstagram #petshop

BURSA ACİL GÜVENLİ BİR YER.. • ACİLLLL!!!!!!!!!!!!! BANA YAZAN KÜÇÜK HAYVAN DOSTUMUZUN ILETİSİNİ PAYLAŞIYORUM. "ABLA BU KEDİ BİR SİTENİN BAHÇESİNE SIĞINMIŞTI BEN OKULA GİDİP GELİRKEN HEP GÖRÜYORDUM SOĞUKLARDA KARLI HAVADA TİTREYEREK SİTENİN KAPISINDA YATIYODU KIYAMADIM ONA KARTONDAN BİR YUVA YAPTIM İÇİNE DE SIRF ÜŞÜMESİN DİYE ANNEMDEN GİZLİ HIRKAMI BİLE KOYDUM UZERINEDE YAZILAR YAZDIM AÇIM NOLUR YEMEK VERİN DIYE KUTUYU SİTENİN YAN TARAFINA KOYDUM AYAK ÜSTÜNDE OLUPTA GÖZE BATMASIN DİYE 2GÜN SONRA BAKTIM YUVA YOK ATMIŞLAR KEDİYİDE ORDAN KOVUP UZAKLAŞTIRMIŞLAR OKADAR ÜZÜLDÜMKİ SONRA Bİ BAKTIM GECE BİZİM APARTMANA GİRMİŞ SOĞUKTAN YATMAK İÇİN KENDİNE YER ARIYO ŞOK OLDUM AMA AILEM İZİN VERMEDİĞİ İÇİN İÇERİ ALAMİYORUM AMA ONA GEÇİCİ OLARAK BÖYLE YATAK YAPTIK O KADAR EVCİMEN O KADAR SADIK BİR KEDİ Kİ GÜNDÜZLERİ KAPI HEP AÇIK OLDUĞU HALDE BİLE TUVALETINI YAPMAK DIŞINDA BI YERE GİTMİYOR AMA APARTMAN GİRİŞİNDE NE ZAMANA KADAR YAŞAR Kİ ZATEN KAÇ KEZ ÜST KATTAKİ KOMŞU ONU KOVDU BEN TEKRAR İÇERİ ALDIM NOLUR ONA BİR YUVA BULALIM BESBELLİ EV KEDİSİ TÜYLERİ BİLE KADİFE GİBİ SANIRIM DIŞARI ATILMIS YADA BAŞKA BİŞEY OLMUŞ AMA EV KEDİSİ OLDUĞU BESBELLİ NE OLUR YARDIM ETTE ONA BİR YUVA BULALIM".... ARKADAŞLAR BU KEDİYE ACILEN BİR YUVA BULMALIYIZ KEDİ 1 YAŞ CİVARİ ERKEKMIŞ APARTMANDAKILERDE KEDİYİ UZAKLAŞTIRMADAN YUVASINA GİTSİN YOKSA YAZIK OLACAK HERKES BOL PAYLAŞIM YAPSIN LÜTFEN KEDİ SAHİPLENMEK İSTEYENLER BU YAVRUYA ÖNCELİK TANISIN🙏🙏 YUVA OLMAK ISTEYENLER MESAJLA VE YA 05307005916'DAN BENİMLE İRTİBATA GEÇİREBİLİRLER...YER/BURSA • • • • • • • #bursa #bursam #bursada #bursadan #bursaspor #bursaorganizasyon #bursabutikpasta #bursa_insta #kedi #kedicikler #kediseverler #kedisevgisi #kedimanyakları #kedisahiplen #kedisahiplendirme #satınalmasahiplen #bursakedisahiplendirme #hayvansever #hayvanseverler #hayvansevgisi #yavrukedi #yavrukedisahiplen #yavrukedisahiplendirme #bursakedisahiplendirme #cat #cats #instacat #acil #bursaacil

İki önceki paylaşımımızdaki öğretmenimizden ilham alarak, güzel ve anlamlı karne hediyeleri hazırlayan bir başka iyi yürekli öğretmenimiz. 👏👏 sağolun, varolun. İyi ki varsınız 🐾❤️ @ajanimo • • • • • • • #sokaktakicanlar #birkapsubirkapmama #öğretmen #bursa #bursam #bursada #bursadan #bursaspor #bursaorganizasyon #bursabutikpasta #bursa_insta #kedi #kedicikler #kediseverler #kedisevgisi #kedimanyakları #kedisahiplen #kedisahiplendirme #satınalmasahiplen #bursakedisahiplendirme #hayvansever #hayvanseverler #hayvansevgisi #yavrukedi #yavrukedisahiplen #yavrukedisahiplendirme #bursakedisahiplendirme #cat #cats #instacat

Bu güzel surata yuva aranıyor. Tatlılığa bakın😍 . . İlan metni: . ANKARA. İki aylık erkek, bir aydır klinikte tedavi görüyor. Gözleri puslu ama görüyor. Damla damlatmak gerekiyor gözlerine onun dışında ekstra bi bakıma ihtiyacı yok. Ankara içi ulaşımını sağlayabilirim. Yuva olmak isterseniz: 05363966979. . . . #kedisahiplendirme #kedisahiplen #kedisahiplenme #kedisahiplendir #yuvaol #yuvaarıyor #yuvaaranıyor #acilyuva #yuvaolhayatkurtar #yuva #kediyuva #satınalmasahiplen #satinalmasahiplen #yavrukedisahiplen #yavrukedi #kedilerindünyası #kediler #kedi #acilyuvaaranıyor #kediseverler #istanbulkedisahiplendirme

ERKEK BURSA İLETİŞİM: 0532 052 76 62 (Ulaşamazsanız Whatsapp tan kendinizi tanıtan bir mesaj yollamanızı rica ederiz. Tarafınıza dönüş yapılacaktır.) Her gün farklı bir dostumuzu ailesine kavuştururken başka dostlarda aramıza katılıyor. Cinsi hakkında bilgim yok. Sokaklarda yaşıyormuş. Hallettiği yer bir kaldırım taşı değilde bir yastık olmalı. Ömrü boyunca hakettiği hayatı sunacak ailesini arıyoruz. İlanın paylaşımında desteklerinizi esirgemeyiniz. Hep birlikte ailesini bulalım. • • • • • • #bursa #bursam #bursada #bursadan #bursaspor #bursaorganizasyon #bursabutikpasta #bursa_insta #kedi #kedicikler #kediseverler #kedisevgisi #kedimanyakları #kedisahiplen #kedisahiplendirme #satınalmasahiplen #bursakedisahiplendirme #hayvansever #hayvanseverler #hayvansevgisi #yavrukedi #yavrukedisahiplen #yavrukedisahiplendirme #bursakedisahiplendirme #cat #cats #instacat #köpek #bursaköpeksahiplendirme

BURSA YUVA Merhaba, 4 aylık dişi tekir. Bebek olduğu için oyun oynamayı çok seviyor ve uysal bir kedi hiçbir yere zarar vermiyor. İç ve dış parazitlerini yaptırdım. Tuvalet eğitimi var, kuru mama yiyor. Petbox, kum ve mama kabını da vereceğim. Iletişim 0542 565 2386 • • • • • • • #bursa #bursam #bursada #bursadan #bursaspor #bursaorganizasyon #bursabutikpasta #bursa_insta #kedi #kedicikler #kediseverler #kedisevgisi #kedimanyakları #kedisahiplen #kedisahiplendirme #satınalmasahiplen #bursakedisahiplendirme #hayvansever #hayvanseverler #hayvansevgisi #yavrukedi #yavrukedisahiplen #yavrukedisahiplendirme #bursakedisahiplendirme #cat #cats #instacat #tekirkedi #yavrutekir #tekirkedisahiplen

Bursa yuva arıyor. Dişi 3 - 3.5 aylık kadar.iyi huylu sosyal bir kedi.sokağa terk edilmiş bulundu.bir daha terk edilmeyeceği ailesini arıyor.iletisim Meral Seymen Sütman @seymen_zuzu • • • • • • • #bursa #bursam #bursada #bursadan #bursaspor #bursaorganizasyon #bursabutikpasta #bursa_insta #kedi #kedicikler #kediseverler #kedisevgisi #kedimanyakları #kedisahiplen #kedisahiplendirme #satınalmasahiplen #bursakedisahiplendirme #hayvansever #hayvanseverler #hayvansevgisi #yavrukedi #yavrukedisahiplen #yavrukedisahiplendirme #bursakedisahiplendirme #cat #cats #instacat

Bebeklere yuva💜 İletii👇 7.5 aylık iki kardeş yavru kediye çok acil yuva bulmamız gerekiyor. Evin kedisi yavrulardan çok huzursuz ve üçü de birbiriyle kavga ediyorlar. Yavruları rehabilitasyon merkezi kabul etmiyor, evde doğup büyüdükleri için. Yuva bulanmazsa malesef sokağa bırakmak zorundayız. Yer istanbul. Yakın şehirlerden yuva bulunursa getirebiliriz. İletişim: @muhammedzs 05376585622 #sahiplendirme #sahiplen #satinalmasahiplen #kedisahiplen #kedilereyuva #patilereyuva #acilömürlükyuva #yavrukedilereyuva #yavrukedisahiplen #hayvansahiplenme #catlove

Minik bebeğe yuva💜 İletii👇 ‼️ACİL‼️ Merhaba, bu kediciği iki gün önce sokakta buldum. 1-2 aylık bir yavru kedi ve maalesef gözleri görmüyor. Babamın alerjisi olduğu için maalesef gizlice bir gecelik eve alabildim. Şu an tanıdığım bir teyzenin evinde kalıyor ama kendisi yaşlı olduğu için ancak pazartesiye kadar bakabilirim. Konumum Beykoz’da ve acilen bu yavrucuğa yuva olabilecek ve bakabilecek birisine ihtiyacımız var. Çok şeker ve iyi huylu bir kedi. Ulaşım: 531 685 83 34 #sahiplendirme #sahiplen #satınalmasahiplen #kedisahiplen #kedilereyuva #patilereyuva #acilömürlükyuva #hayvansahiplenme #yavrukedilereyuva #yavrukedisahiplen #catlove

Tatlı çöreklerim, pamuk şekerlerim artık yeni ailelerinde 🤗🤗🤗 . İnşallah yeni evlerinde bir ömür şans huzur mutluluk bolluk bereket getirirler 🧿🧿🧿 . . Henüz 1 haftalık olan yeni golden bebeklerimiz de bikaç hafta içinde sayfamızda olacak 🦋🦋🦋🦋 . . . #britishshorthair #britishcat #kedi #kedisahiplenme #kedisahiplendirme #kedicik #kedim #kedigiller #kediseverler #kediaşkı #kedisahiplendirmeplatformu #kedisahiplen #yavrukedisahiplen #yavrukediler #cinskedisahiplendirmeplatformu #cinskedi #cattery #kittenforsale #goldencat #istanbulkedileri #izmirkedileri #pembepanter_cattery

HAYSADER
(@haysader)

1 Day 12 Hours Ago

🚨YUVA ARIYOR🚨👉 1.5 Aylık erkek ömürlük yuvasını arıyoruz. Bu güzel bebeğin ömürlük ailesi olur musunuz? Manisa iletişim için 📞05548662891 #haysader #sokakhayvanlarisahiplendirmedernegi #sokakhayvanlari #satinalmasahiplen #acilyuva #yuvailani #yuvaariyor #ömürlükyuva #kedisahiplen #yavrukedi #yavrukedisahiplen #sokaktansahiplen #hayatkurtar #manisa #izmir #instalike #instacats #instaanimal

Bebislere yuva💜 İletii👇 Merhabalar 🏵️ özge ben. Sokakta kötü halde bulduğum iki yavru vardı tedavileri bitti yuvaya gönderdim ama alerji bahanesiyle geri getirdiler. Benim de evdd 4 kedim var Bi odaya kapatmak zorunda kaldım dövüyorlar çünkü Oda da çok sıkıldılar Renkli dişi diğeri erkek İstanbul Kadiköy İletisim @_ozgeeli #sahiplendirme #sahiplen #kedisahiplen #kedilereyuva #yavrukedilereyuva #yavrukedisahiplen #acilömürlükyuva #patilereyuva #acilömürlükyuva #catlove

#repost @ozlemkocaili (@get_repost) ・・・ Evde biberonla büyüttüğümüz bu dünya tatlılarına yuva arıyorum.. Hepsi evde büyüdü, sokak bilmezler. İç dış parazit tedavileri, tuvalet eğitimleri var. Son derece cana yakın ve uysallar. Tırnak çıkarmak nedir bilmezler. Ulaşımları sağlanır. İstanbul İletişim: 05333227318 @ozlemkocaili #yuva #yuvaaranıyor #yuvaaranıyoristanbul #kedisahiplendirme #kedisahiplen #kedisahiplenme #yavrukedi #yavrukedisahiplen #yavrukedisahiplendirme #adopt #adoption #adoptcat #satınalmasahiplen #kedi #kediköpek #kediarayanlar #pisi

Anıl Akbulut
(@domatessepeti)

1 Day 15 Hours Ago

#repost @halerkoc with @get_repost ・・・ Arkadaşlar, bu çocuğa çok çok acil yuva arıyoruz! Sokakta soğuktan ve açlıktan baygın bulundu, yaşı oldukça ileri ve hasta bir teyzemiz dayanamadı evini açtı ama onunla ilgilenebilecek durumda değil! 3 aylık, erkek, iç-dış paraziti var, sağlıklı bir çocuk! İletişim ben ya da @sineemsipahi Lütfen ilanı yaymamıza yardımcı olur musunuz? #istanbulyuva #istanbulyuvaaranıyor  #satınalmasahiplen #kedisahiplendirme #kedisahiplenme #hayder #haysev #haysader #yavrukedi #yavrukedisahiplen #ömürlükyuva #yuvamolurmusun #yuva #yuvaarıyor #% #yuvamol #petarkadaş #acilyuva #sokakkedisi #engellicanlaraöncelik #adoptdontshop #sahiplen #sahiplendirme #engellicanlarayuva #kedisizolmaz #kedisizasla

Anıl Akbulut
(@domatessepeti)

1 Day 15 Hours Ago

#repost @istanbulkedisahiplendirme with @get_repost ・・・ AİLESİ EVDE İSTEMEDİĞİ İÇİN KEDİYİ ATABİLİRLERMİŞ. İSTANBUL/Dudullu . ÇOK ACİL YUVA ARANIYOR. . Merhaba Batman’a yuva arıyoruz Batman 9 aylık kum eğitimli poposundan parazit yumurtaları çıktığı için 20 gün aralıklı 2 defa aşı yaptırılması gerekiyor ve 15 gün aralıklı ense damlası damlatılması gerekiyor Batman ın bu ihtiyacını karşılayacak ve kısırlaştıracak kişi arıyoruz tüm eşyalarıyla birlikte verilecektir. İLETİŞİM: 05380761204 . . . #kedisahiplendirme #kedisahiplen #kedisahiplenme #kedisahiplendir #yuvaol #yuvaarıyor #yuvaaranıyor #acilyuva #yuvaolhayatkurtar #yuva #kediyuva #satınalmasahiplen #satinalmasahiplen #yavrukedisahiplen #yavrukedi #kedilerindünyası #kediler #kedi #acilyuvaaranıyor #kediseverler #istanbulkedisahiplendirme

AİLESİ EVDE İSTEMEDİĞİ İÇİN KEDİYİ ATABİLİRLERMİŞ. İSTANBUL/Dudullu . ÇOK ACİL YUVA ARANIYOR. . Merhaba Batman’a yuva arıyoruz Batman 9 aylık kum eğitimli poposundan parazit yumurtaları çıktığı için 20 gün aralıklı 2 defa aşı yaptırılması gerekiyor ve 15 gün aralıklı ense damlası damlatılması gerekiyor Batman ın bu ihtiyacını karşılayacak ve kısırlaştıracak kişi arıyoruz tüm eşyalarıyla birlikte verilecektir. İLETİŞİM: 05380761204 . . . #kedisahiplendirme #kedisahiplen #kedisahiplenme #kedisahiplendir #yuvaol #yuvaarıyor #yuvaaranıyor #acilyuva #yuvaolhayatkurtar #yuva #kediyuva #satınalmasahiplen #satinalmasahiplen #yavrukedisahiplen #yavrukedi #kedilerindünyası #kediler #kedi #acilyuvaaranıyor #kediseverler #istanbulkedisahiplendirme

Özlem Kocaili
(@ozlemkocaili)

1 Day 19 Hours Ago

Evde biberonla büyüttüğümüz bu dünya tatlılarına yuva arıyorum.. Hepsi evde büyüdü, sokak bilmezler. İç dış parazit tedavileri, tuvalet eğitimleri var. Son derece cana yakın ve uysallar. Tırnak çıkarmak nedir bilmezler. Ulaşımları sağlanır. İstanbul İletişim: 05333227318 @ozlemkocaili #yuva #yuvaaranıyor #yuvaaranıyoristanbul #kedisahiplendirme #kedisahiplen #kedisahiplenme #yavrukedi #yavrukedisahiplen #yavrukedisahiplendirme #adopt #adoption #adoptcat #satınalmasahiplen #kedi #kediköpek #kediarayanlar #pisi

- صوت القطة يجنن واو 😘☺

#repost @bursasahiplendirme (@get_repost) ・・・ BURSA YUVA 0553 555 38 99 yuva arıyoruz muhtemelen 1 buçuk 2 yaşında erkek arka ayaklarında enfeksiyon olduğu için tedavi gördü tedavisi bitmek üzere. Ona yuva arıyoruz. Lütfen paylaşın. • • • • • • • #bursa #bursam #bursada #bursadan #bursaspor #bursaorganizasyon #bursabutikpasta #bursa_insta #kedi #kedicikler #kediseverler #kedisevgisi #kedimanyakları #kedisahiplen #kedisahiplendirme #satınalmasahiplen #bursakedisahiplendirme #hayvansever #hayvanseverler #hayvansevgisi #yavrukedi #yavrukedisahiplen #yavrukedisahiplendirme #bursakedisahiplendirme #cat #cats #instacat

İks
(@istanbulkedisahiplendirme)

2 Days 15 Hours Ago

4 aylık dişi, çok sevecen ve sakin güzelliğe ömürlük yuva arıyorum. Tüm ilk veteriner muayenesi, iç-dış parazitini, karnesini ben karşılayacağım.  Yer:İstanbul - Bakırköy İletişim: instagram: @sabriyesoner . . . #kedisahiplendirme #kedisahiplen #kedisahiplenme #kedisahiplendir #yuvaol #yuvaarıyor #yuvaaranıyor #acilyuva #yuvaolhayatkurtar #yuva #kediyuva #satınalmasahiplen #satinalmasahiplen #yavrukedisahiplen #yavrukedi #kedilerindünyası #kediler #kedi #acilyuvaaranıyor #kediseverler #istanbulkedisahiplendirme

ILETISIM 👉 @sabriyesoner - 7 haftalık tatloş kardeşler, inanılmaz güzel ve sağlıklılar evde büyüdüler 🤗 çok sevilecekleri ömürlük yuvalarını arıyorum🙏 Yer: İstanbul. 🙏 . . . . . #kedi #kedisahiplenme #kedisahiplendirme #yuvaol #istanbulkedisahiplendirme #yuvanıaç #birhayatkurtar #bircankurtar #satınalmasahiplen #yavrukedi #yavru #yavrukedisahiplen #yavrukedisahiplendirme - #regrann

Çok özel renkleri ile scottish straight Minti kızımız rezerveye müsaittir iletişim için lütfen mesaj atınız. #scottishfoldkitten #scottishfold #britishshorthair #kitten#kedimamasi#goldenbritishshorthair#yavrukedi #yavrukedisahiplen #cinskedisahiplendirmeplatformu

@erguncakiir ‘ın iletisidir! “ İyi günler istanbul kadıköyde evcil 6 aylık kedi var başkaları tarafından sokağa terk edilecekti bende güzel bir yuvaya sahiplendirene kadar bakmak için aldım tuvalet eğitimi var kum kabı taşıma çantası herşeyi var sahiplendirmek istiyorum sokakta yaşıyamıycağını biliyorum yardımcı olursanız çok sevinirim” #istanbulkedisahiplendirme #kadıköyhayvanhakları #kadıköyhayvandostlarıplatformu #bircandasenkurtar #yuvaarıyor #yavrukedi #yavrukedisahiplen

HAYSADER
(@haysader)

3 Days 1 Hour Ago

🚨YUVA ARIYOR🚨👉3 Aylık dişi ömürlük yuvasını arıyor. Tuvalet eğitimi var. Videoda görüldüğü gibi sevgi delisi çok tatlı bir bebek. Onun ailesi siz olur musunuz? Manisa iletişim için 📞05456137058 #haysader #sokakhayvanlarisahiplendirmedernegi #manisa #izmir #acilyuva #ömürlükyuva #sahiplen #satinalmasahiplen #yavrukedi #yuvaol #hayatkurtar #instacats #kedisahiplen #kediilani #kedisahiplendirme #yavrukedisahiplen #instagram #instalike

Aysenur 🌸
(@patilerinsesiol)

3 Days 11 Hours Ago

#repost @ istanbulkedisahiplendirme (@ get_repost) ・・・ İsmi mımır kum vs eğitimi var 4 aylık erkek İstanbulda sahiplendirme yapabilirlermiş Zeytinburnu’nda bu şekerpare İLETİŞİM: @ sgksln61 . . . #kedisahiplendirme #kedisahiplen #kedisahiplenme #kedisahiplendir #yuvaol #yuvaarıyor #yuvaaranıyor #acilyuva #yuvaolhayatkurtar #yuva #kediyuva #satınalmasahiplen #satinalmasahiplen #yavrukedisahiplen #yavrukedi #kedilerindünyası #kediler #kedi #acilyuvaaranıyor #kediseverler #istanbulkedisahiplendirme

kayıpcanlar
(@kayipcanlar)

3 Days 12 Hours Ago

#repost @istanbulkedisahiplendirme 🚨YUVA🚨7 haftalık sağlıklı ve sevecen yavrulara yuva arıyoruz. Hepsi dişi. Yer:İstanbul, İletişim: instagram: @sabriyesoner . . . #kedisahiplendirme #kedisahiplen #kedisahiplenme #kedisahiplendir #yuvaol #yuvaarıyor #yuvaaranıyor #acilyuva #yuvaolhayatkurtar #yuva #kediyuva #satınalmasahiplen #satinalmasahiplen #yavrukedisahiplen #yavrukedi #kedilerindünyası #kediler #kedi #acilyuvaaranıyor #kediseverler #istanbulkedisahiplendirme

@sabriyesoner 7 haftalık tatloş kardeşler, inanılmaz güzel ve sağlıklılar evde büyüdüler 🤗 çok sevilecekleri ömürlük yuvalarını arıyorum🙏 Yer: İstanbul. 🙏 . #kedi #kedisahiplenme #kedisahiplendirme #yuvaol #istanbulkedisahiplendirme #yuvanıaç #birhayatkurtar #bircankurtar #satınalmasahiplen #yavrukedi #yavru #yavrukedisahiplen #yavrukedisahiplendirme

Sibel&Hasan
(@sibelerginses)

2 Days 22 Hours Ago

GÜNCELLEME ☝️3 GÜZELLİK DE YUVALANDI🙏 Yardımın ve desteğin için çooook teşekkürler. Sen olmadan bu m8nnoşlar bu kadar çabuk ve güzel ailelere sahip olamazlardi. Sen çok güzel, sağlıklı ve de uzuuuuun yaşa emi @sabriyesoner 💞😘 . . 😻 Bu guzel ve tatlış kızlar 7 haftalık 😻 Artık üçünün de yeni yuvalarına gitme zamanı geldi. 😻Ben ömürlük yuva olup sevip öpüp koklarım, onu hiç bırakmam diyenler dm den benimle iletişime geçebilir. 😻Hadi bu kızlara bir an önce ömürlük yuvalar bulalım.🙏 . 😻😻😻😻😻😻😻😻😻😻😻😻😻😻 #yuvaol #yuvaolhayatkurtar #satinalmasahiplen #kedisahiplenme #kedisahiplendirme #yavrukedisahiplen #yavrukedi #yavrukedisahiplendirme #kediseverler #kediler #kedicik #yuvaariyor

🌻
(@aciz.r)

3 Days 14 Hours Ago

Himalayan İran kedilerimiz ücretli sahiplendirilecektir. 4 tane 1 yaşında dişi 1 tane 1 yaşında erkek 1 tane 2 yaşında dişi kedimiz mecvuttur. Ciddi alıcılar mesaj yoluyla iletişim kurabilir. #irankedisi #irankedisiyavrulari #irankedisisahiplendirme #kedisahiplendirme #kedisahiplenme #kedisahiplenmekisteyen #kedisahiplen #ücretlikedisahiplendirme #cinskedisahiplendirmeplatformu #yavrukedisahiplen #yavrukedisahiplendirme

BURSA YUVA Bu Kara Kız yağmurda sırılsıklam olmuş bulundu.temizlendi paklandı yuvasını arıyor-3 aylık dişi kuru mama yiyor kum kullanıyor.bir canlıya bakma sorumluluğunun farkında olan kişilere sahiplendirilecektir/Bursa İletişim: @unal.hasibe @mia_mioska • • • • • • • #bursa #bursam #bursada #bursadan #bursaspor #bursaorganizasyon #bursabutikpasta #bursa_insta #kedi #kedicikler #kediseverler #kedisevgisi #kedimanyakları #kedisahiplen #kedisahiplendirme #satınalmasahiplen #bursakedisahiplendirme #hayvansever #hayvanseverler #hayvansevgisi #yavrukedi #yavrukedisahiplen #yavrukedisahiplendirme #bursakedisahiplendirme #cat #cats #instacat #siyahkedi #siyahkedisahiplen #karakedi

Bursa YUVA 2 yaşında dişi , bebekleri olduğu için bu güzelliği sahiplendirmek istiyorlar. Eşyaları ile sahiplendirilecekmiş.Bu güzelliği sahiplenmek isteyen olur mu 0544 670 49 49 • • • • • • #bursa #bursam #bursada #bursadan #bursaspor #bursaorganizasyon #bursabutikpasta #bursa_insta #kedi #kedicikler #kediseverler #kedisevgisi #kedimanyakları #kedisahiplen #kedisahiplendirme #satınalmasahiplen #bursakedisahiplendirme #hayvansever #hayvanseverler #hayvansevgisi #yavrukedi #yavrukedisahiplen #yavrukedisahiplendirme #bursakedisahiplendirme #cat #cats #instacat

BURSA YUVA 0553 555 38 99 yuva arıyoruz muhtemelen 1 buçuk 2 yaşında erkek arka ayaklarında enfeksiyon olduğu için tedavi gördü tedavisi bitmek üzere. Ona yuva arıyoruz. Lütfen paylaşın. • • • • • • • #bursa #bursam #bursada #bursadan #bursaspor #bursaorganizasyon #bursabutikpasta #bursa_insta #kedi #kedicikler #kediseverler #kedisevgisi #kedimanyakları #kedisahiplen #kedisahiplendirme #satınalmasahiplen #bursakedisahiplendirme #hayvansever #hayvanseverler #hayvansevgisi #yavrukedi #yavrukedisahiplen #yavrukedisahiplendirme #bursakedisahiplendirme #cat #cats #instacat

BURSA YUVA 0553 555 38 99 yuva arıyoruz muhtemelen 1 buçuk 2 yaşında erkek arka ayaklarında enfeksiyon olduğu için tedavi gördü tedavisi bitmek üzere. Ona yuva arıyoruz. Lütfen paylaşın. • • • • • • • #bursa #bursam #bursada #bursadan #bursaspor #bursaorganizasyon #bursabutikpasta #bursa_insta #kedi #kedicikler #kediseverler #kedisevgisi #kedimanyakları #kedisahiplen #kedisahiplendirme #satınalmasahiplen #bursakedisahiplendirme #hayvansever #hayvanseverler #hayvansevgisi #yavrukedi #yavrukedisahiplen #yavrukedisahiplendirme #bursakedisahiplendirme #cat #cats #instacat

Rezervesi iptal olan scottish fold bebeğimiz Rose ücretli sahiplendirelecektir. #kedicik #yavrukedi #yavrukedisahiplen #cinskedisahiplendirmeplatformu#kedikumu #scottishfold #britishshorthair

Bebeklere acil yuva❣ İletii👇 Kardeşim iyi akşamlar bir sokak kedimiz vardı gel git baya alıştı bize 4 yavru verdi 4. Aya girdiler ve anneleri geçen ay bıraktı bu ay birisi kayboldu birisi az önce öldü ellerimle göndüm ölümü biraz karışık kimse merak etmesin elimden gelen her şeyi yaptım kalan iki yavru var ve sahiplendirmek istiyorum şu an akşam olduğu için fotoğraf atamıyorum sabah çekip atarım senden ricam bunu paylaşman ve kalan 2 yavrunun sahiplenilmesi ve hayatta kalması tek isteğim ,il Osmaniye merkez çevre illere için de görüşebiliriz aşılarının hiçbir yapılmadı elimden geldiğince de yardımcı olurum iki yavru da sevecen ve cana yakın En öndeki ve en arkadaki mevcut şu anda siyah kayboldu diğer sarı öldü İletisim @1zencoo #sahiplendirme #sahiplen #kedisahiplen #kedilereyuva #acilömürlükyuva #patilereyuva #hayvanlarayardim #hayvansahiplendirme #yavrukedilereyuva #yavrukedisahiplen #catlove

Lütfen paylaşıp arkadaşlarınızı etiketler misiniz? bu minnoşlar yuvalarına kavuşsun, bizim yerimiz olsa biz eve alacağız,sahiplenmek isteyenlere de mama desteğinde bulunacağız,izmir-istanbul ve arası için kedicikleri getirebiliriz #kedisahiplendirme #izmirkedisahiplendirme #sokakhayvanlari #sohayko #istanbulkedisahiplendirme #kedisahiplendirme #kedisahiplendirmeplatformu #kedisahiplenmekisteyen #izmirkedi #izmirkediseverler #yavrukedisahiplen #yavrukedisahiplendirme @pamuk.pepe.pure.efe

İks
(@istanbulkedisahiplendirme)

3 Days 21 Hours Ago

Bu kediyi sahiblendirmek istiyorum 2 ay once bizim fabrikaya geldi gitmiyo sahibi varsa bana ulaşsın bu numaradan 0544 236 4030 fabrikada istenmiyo sokağa atılmasını istemiyorum vicdanlı merhametli insanlar bekliyorum . . . #kedisahiplendirme #kedisahiplen #kedisahiplenme #kedisahiplendir #yuvaol #yuvaarıyor #yuvaaranıyor #acilyuva #yuvaolhayatkurtar #yuva #kediyuva #satınalmasahiplen #satinalmasahiplen #yavrukedisahiplen #yavrukedi #kedilerindünyası #kediler #kedi #acilyuvaaranıyor #kediseverler #istanbulkedisahiplendirme

Sabaha bir Zeus şekerliği bırakalım... Ailesinin gözbebeği Zeus #cat #cats#catsagram #scottishfold#britishshorthair #gununfotosu #yavrukedi#yavrukedisahiplen

Aysenur 🌸
(@patilerinsesiol)

4 Days 8 Hours Ago

#repost @istanbulkedisahiplendirme (@get_repost) ・・・ 2 aylık çakıl lösemi hastası ve evde bakıma muhtaç bir bebek , ben elimde olmayan nedenlerden dolayı sahiplendirmek zorundayım. Aşıları yapıldı 2 ay sonra tekrar yapılacak asilarini veteriner hediye etti (iç dış parazit) . Maması kumu tuvalet kabı her şeyi var , eğitimli. Sevgiye çok ihtiyaci var . İstanbul bahçelievler de . İrtibat 05071915940 . . . #kedisahiplendirme #kedisahiplen #kedisahiplenme #kedisahiplendir #yuvaol #yuvaarıyor #yuvaaranıyor #acilyuva #yuvaolhayatkurtar #yuva #kediyuva #satınalmasahiplen #satinalmasahiplen #yavrukedisahiplen #yavrukedi #kedilerindünyası #kediler #kedi #acilyuvaaranıyor #kediseverler #istanbulkedisahiplendirme

!sm@!L
(@sessizkullarinsesi)

4 Days 11 Hours Ago

#repost from @k.sahiplendirme by @fastsave_app ••• Merhaba erkek kedi tahmini 4-5 aylık gibi tekir cinsi sokakta buldum evde kedim var diye kendim bakamıyorum aşılarını yaptırdım artık çok kavga ediyorlar mecbur sahiplendirmek durumundayım paylaşırsanız çok sevinirim. ILETISIM @rabiiaay @evin_kedisimi @kedi_sahiplendirme @kedikopeksahiplendir @kedisahiplenelim @kedi_pati_dost @kedikopekdostsahiplendirme @kedimleevlenirmisin @scottishfoldsilver @kedisevprivv @kedi @kedinizin_teyzesi @kedikasabasi @kediversite @evdekedibakicisi @kedilik_muessesesi @evde.kedi.iyidirrr @kediotelii @kediligiller_ @kedipatiii @kediliev.tv @catanddogdergi @kedimmiyu @kedi.kat @kedilikadin04 @yuva_arayan_kedi_kopekler @yuvalamaca @patilere.acil.yuva @banayuvaol @yuva.sayfasi @yuvasiz_patiler @yuva @biryuvamolsun @yuva.araniyor @yuvasizmelekler @yuvaszpatiler @kedili.yasam @yuva.ariyan.patiler @engellicanlarayuva @yuvapati @yuvaarayanpatiler @yuvaouhayhak @sokaktaki.patilere.yuva @kedi_sahiplendirme @beni_sahiplen @kedi_pati_dost @hayvansahiplendirmee @sahipsiz.patilerr @kedikopekdostsahiplendirme @kedipatisisema @satin_alma_sahiplen @ouhayhak @ayguncavdar @patilerinsesiol @aysegultutanlar @sessizkullarinsesi @haytap_sahiplendirme @haytap @masum__gozler @sahipsiz_masum_canlar @p.atili.gunler #kedi #kediler #kedicikler #kedisahiplendirme #kedisahiplenme #kedisahiplen #kedigiller #kedievi #sarman #sarmankedi #yavrukedi #yavrukedisahiplen #yavrukedisahiplendirme #sahiplendirmeilani #sahiplendirme #sahiplen #sessizkullar #sessizkullardıronlar #sokakkedisi #sokakcanlari #sahipsizcanlar #sahipsizhayvanlar #yuvaarıyor #yuvalandirma #yuva

Merhaba erkek kedi tahmini 4-5 aylık gibi tekir cinsi sokakta buldum evde kedim var diye kendim bakamıyorum aşılarını yaptırdım artık çok kavga ediyorlar mecbur sahiplendirmek durumundayım paylaşırsanız çok sevinirim. ILETISIM @rabiiaay ISTANBUL KAĞITHANE @evin_kedisimi @kedi_sahiplendirme @kedikopeksahiplendir @kedisahiplenelim @kedi_pati_dost @kedikopekdostsahiplendirme @kedimleevlenirmisin @scottishfoldsilver @kedisevprivv @kedi @kedinizin_teyzesi @kedikasabasi @kediversite @evdekedibakicisi @kedilik_muessesesi @evde.kedi.iyidirrr @kediotelii @kediligiller_ @kedipatiii @kediliev.tv @catanddogdergi @kedimmiyu @kedi.kat @kedilikadin04 @yuva_arayan_kedi_kopekler @yuvalamaca @patilere.acil.yuva @banayuvaol @yuva.sayfasi @yuvasiz_patiler @yuva @biryuvamolsun @yuva.araniyor @yuvasizmelekler @yuvaszpatiler @kedili.yasam @yuva.ariyan.patiler @engellicanlarayuva @yuvapati @yuvaarayanpatiler @yuvaouhayhak @sokaktaki.patilere.yuva @kedi_sahiplendirme @beni_sahiplen @kedi_pati_dost @hayvansahiplendirmee @sahipsiz.patilerr @kedikopekdostsahiplendirme @kedipatisisema @satin_alma_sahiplen @ouhayhak @ayguncavdar @patilerinsesiol @aysegultutanlar @sessizkullarinsesi @haytap_sahiplendirme @haytap @masum__gozler @sahipsiz_masum_canlar @p.atili.gunler #kedi #kediler #kedicikler #kedisahiplendirme #kedisahiplenme #kedisahiplen #kedigiller #kedievi #sarman #sarmankedi #yavrukedi #yavrukedisahiplen #yavrukedisahiplendirme #sahiplendirmeilani #sahiplendirme #sahiplen #sessizkullar #sessizkullardıronlar #sokakkedisi #sokakcanlari #sahipsizcanlar #sahipsizhayvanlar #yuvaarıyor #yuvalandirma #yuva

Yavrum baban nereli, nereden bu kaşın gözü temeli, sana neler demeli ay seni çıtır çıtır yemeli... Candy çok güzelsin ya He kimin torunu 😀😀😀 #cat #cats#catsagram #scottishfold#britishshorthair #gununfotosu #yavrukedi#yavrukedisahiplen #scottishfoldkitten

Bebeklere acil yuva❣ İletii👇 Kardeşim iyi akşamlar bir sokak kedimiz vardı gel git baya alıştı bize 4 yavru verdi 4. Aya girdiler ve anneleri geçen ay bıraktı bu ay birisi kayboldu birisi az önce öldü ellerimle göndüm ölümü biraz karışık kimse merak etmesin elimden gelen her şeyi yaptım kalan iki yavru var ve sahiplendirmek istiyorum şu an akşam olduğu için fotoğraf atamıyorum sabah çekip atarım senden ricam bunu paylaşman ve kalan 2 yavrunun sahiplenilmesi ve hayatta kalması tek isteğim ,il Osmaniye merkez çevre illere için de görüşebiliriz aşılarının hiçbir yapılmadı elimden geldiğince de yardımcı olurum iki yavru da sevecen ve cana yakın En öndeki ve en arkadaki mevcut şu anda siyah kayboldu diğer sarı öldü İletisim @1zencoo #sahiplendirme #sahiplen #kedisahiplen #kedilereyuva #acilömürlükyuva #patilereyuva #hayvanlarayardim #hayvansahiplendirme #yavrukedilereyuva #yavrukedisahiplen #catlove

Güzel kızın son şansı🍀 Yumuşak karakterli, sevgi dolu🥰 İlk kez kedi bakacaklar için uygun🐾9 aylık, kısır, iç ve dış parazitleri tam. İstanbul- Beşiktaş İletişim için Tilia Vet Klin: 0212 232 71 34 (Pzts-Cmts 09:30-19:00) #acilyuva #yuvaarıyor #yuvaariyor #evariyor #hayvansevgisi #hayvanseverler #kediseverler #herevebirkedi #hayvanseveryerler #satinalmasahiplen #dontshopadopt #kediistiyorum #yavrukedi #yavrukedisahiplen #sahiplen #sahiplendirme #ücretsizsahiplendirme #kedisahiplen #kedisahiplendirme #sahipsensin #sahiplen #acilyuva #yuvalandirma #adoption #yuvamol #yuvaarıyorum #yuvaariyorum #yuvalandırma #kedi #kedimol #tiliavet #tiliaveteriner

Bebişe yuva💜 İletii👇 Merhaba erkek kedi tahmini 4-5 aylık gibi tekir cinsi sokakta buldum evde kedim var diye kendim bakamıyorum aşılarını yaptırdım artık çok kavga ediyorlar mecbur sahiplendirmek durumundayım paylaşırsanız çok sevinirim karnesinide çıkarttım kendi kedim dişi olduğu için artık anlaşamıyorlar telefon numaram 05414552834 istanbul #sahiplendirme #sahiplen #kedisahiplen #kedilereyuva #acilömürlükyuva #patilereyuva #hayvansahiplendirme #yavrukedilereyuva #yavrukedisahiplen #catlove

#repost @domatessepeti • • • • • #repost @istanbulkedisahiplendirme with @get_repost ・・・ Kedimin adı Duman gerçekten dünyanın en tatlı kedisi biz onu ve o bizi çok seviyordu ama annemin alerjisi çıktı ve dumanı vermek zorunda kaldık☹️ ve şimdi dumana ömürlük yuva arıyorum doğduğundan beri bütün aşıları yapılı 4 aylık erkek tuvalet eğitimli ve adını söyleyince gelen bir kedi çok oyuncu ve meraklı bir kedi duman toplara bayılır oyun delisidir eğer başı sıkışırsa miyavlar 7 den 24 bütün malzemeleri tam İstanbul’da oturan birine vermek ve onu ziyaret etmek çok isteriz onu çok seviyoruz inşallah yuvalanır çünkü sokağa atmaya kıyamıyoruz bana @figen_melek__ den ulaşabilirsiniz . . . #kedisahiplendirme #kedisahiplen #kedisahiplenme #kedisahiplendir #yuvaol #yuvaarıyor #yuvaaranıyor #acilyuva #yuvaolhayatkurtar #yuva #kediyuva #satınalmasahiplen #satinalmasahiplen #yavrukedisahiplen #yavrukedi #kedilerindünyası #kediler #kedi #acilyuvaaranıyor #kediseverler #istanbulkedisahiplendirme

Çarli çaplin kedi, 1buçuk aylık iç dış parazit aşıları yapılmış.. Gebze @canceyhanulu06 #kedi #kediyuvası #kediyuvalandırma #yuvaarayankedi #petyuva #yavrukedisahiplen #yavrukedisahiplendirme #petcenter #petshop #gebze #darıca #çayırova #mutlukent #kocaeli #istanbul #izmit #tuzla

Güzel olan her şeyin bir emeği bir bedeli vardır ... Bilgi , birikim araştırma ve tecrübe ... Anneye babaya özenli bakım özenle seçilen mamalar ek vitaminler , ek besin takviyeler yaşam alanlarının sürekli bakımı ... Kaliteli ırk seçimleri muhteşem tüy ve yüz yapıları ... En önemlisi sonu olmayan sevgi ... #britishshorthair #kedimbenim